Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Common NameOsI_08446
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 804aa    MW: 86077.3 Da    PI: 5.4935
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA005852-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe+lF+++++p++++r+eL+++l+L+ rqVk+WFqNrR+++k
                       678899***********************************************999 PP

             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvla.llveellddkeqWdetla.... 77 
                       ela +a++elvk+a+ ++p+Wv         e +n +e+l +f +  +     + +ea+r+sg+v+ +    lve+l+d + +W+ ++     
                       57889*****************99978888888888888888888877*****************9876658999999999.*********** PP

             START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd..seqkppe...sssvvRaellpSgiliepks 158
                       ka++le +s+g      gal lm+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d  ++++++    + + v++++ pSg+++++++
                       ************************************************************96556666667678899**************** PP

             START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       **********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.12396156IPR001356Homeobox domain
SMARTSM003891.5E-1997160IPR001356Homeobox domain
CDDcd000865.35E-1998156No hitNo description
PfamPF000469.5E-1999154IPR001356Homeobox domain
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PROSITE profilePS5084845.039305549IPR002913START domain
SuperFamilySSF559612.91E-32308546No hitNo description
CDDcd088751.23E-113309545No hitNo description
SMARTSM002341.5E-47314546IPR002913START domain
PfamPF018523.7E-51315546IPR002913START domain
SuperFamilySSF559613.41E-21567770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 804 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.60390.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016480.0AB101648.1 Oryza sativa Japonica Group Roc5 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625616.10.0PREDICTED: homeobox-leucine zipper protein ROC5
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA0A0E0GB770.0A0A0E0GB77_ORYNI; Uncharacterized protein
TrEMBLB8AGG20.0B8AGG2_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA005852-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1